Protein Info for PGA1_c14730 in Phaeobacter inhibens DSM 17395

Annotation: ammonia channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 40 to 63 (24 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 198 to 215 (18 residues), see Phobius details amino acids 227 to 247 (21 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details amino acids 338 to 338 (1 residues), see Phobius details amino acids 341 to 361 (21 residues), see Phobius details TIGR00836: ammonium transporter" amino acids 5 to 389 (385 residues), 370.6 bits, see alignment E=4.9e-115 PF00909: Ammonium_transp" amino acids 7 to 389 (383 residues), 338.6 bits, see alignment E=2.2e-105

Best Hits

Swiss-Prot: 46% identical to Y663_METTH: Putative ammonium transporter MTH_663 (MTH_663) from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)

KEGG orthology group: K03320, ammonium transporter, Amt family (inferred from 88% identity to sil:SPO2093)

Predicted SEED Role

"Ammonium transporter" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E0D3 at UniProt or InterPro

Protein Sequence (393 amino acids)

>PGA1_c14730 ammonia channel (Phaeobacter inhibens DSM 17395)
MNAADTAWIIVATALVLFMTLPGLALFYGGLVRARNVLSVFMQCYAIACLMSVLWLAFGY
SIAFGSGTSGVWGGLDKMFLSGVTADSLSGTLPEVLFFAFQMTFAIITPALIVGAYVERV
GFGFVLVFSGLWMLLCYAPVVHWIWGGGMLADGGIFGEVGVRDFAGGIVVHETAGLAALI
IAVFLGPRKNRTTPPHNPGYVFIGAAMLWVGWFGFNGGSQLAADGGAAMALTVTHISAAT
ASLTWALWEKIKYGKASMVGLVTGTIAGLASITPASGFVGPVEALVIGAVAGILCQEAVN
VVRNLLKIDDTLDVFAVHGVGGIFGTIMIAVFGAGSWFAQVGGLVVVGVFTAVVTVVLVK
VTAAITPLRVDLETETNGLDITVHGERAYDMTS