Protein Info for HP15_1413 in Marinobacter adhaerens HP15

Annotation: protein containing GCN5-related N-acetyltransferase domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 PF13302: Acetyltransf_3" amino acids 22 to 169 (148 residues), 36.6 bits, see alignment E=1.4e-12 PF00583: Acetyltransf_1" amino acids 60 to 168 (109 residues), 48.7 bits, see alignment E=1.8e-16 PF13508: Acetyltransf_7" amino acids 73 to 170 (98 residues), 33.5 bits, see alignment E=8.8e-12 PF13673: Acetyltransf_10" amino acids 112 to 173 (62 residues), 28.4 bits, see alignment E=2.9e-10

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJJ1 at UniProt or InterPro

Protein Sequence (191 amino acids)

>HP15_1413 protein containing GCN5-related N-acetyltransferase domain (Marinobacter adhaerens HP15)
MLLAKVERELQVAVNQAKRGFVIREAREEDLPEMVGFLAKLALHVSGAPPHDLKESEYKR
LLRTLHSALDDPNRRLVVAESKSAGLVGMGYVYIWRSQGIWEQSEAAEFKSGVIDDIWVE
PDFRGLGILKALLRDLVTFAEEHHASELILEYSASNKEAKAAWTKLGFKPTGVRAAAFTS
VVKQALAESQG