Protein Info for HP15_1411 in Marinobacter adhaerens HP15

Annotation: hypothetical 3-methyladenine DNA glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 PF03352: Adenine_glyco" amino acids 48 to 129 (82 residues), 51.1 bits, see alignment E=7.8e-18

Best Hits

KEGG orthology group: None (inferred from 73% identity to maq:Maqu_0280)

Predicted SEED Role

"DNA-3-methyladenine glycosylase (EC 3.2.2.20)" in subsystem DNA Repair Base Excision (EC 3.2.2.20)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.20

Use Curated BLAST to search for 3.2.2.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJI9 at UniProt or InterPro

Protein Sequence (221 amino acids)

>HP15_1411 hypothetical 3-methyladenine DNA glycosylase (Marinobacter adhaerens HP15)
MSFSRIYEQAVLQKGGESEVLARLPRVAAPGELEALGDDRYLSEITRCIFKAGFVWRVIE
NKWPKFEEAFEGFVPLYWQQVPPEVLERLAGDERIVRNAQKIQTVPENARMIVDASREHG
SFGKFLANWPSSDQAGLLMWLKRNGARLGGNSAQYFLRRVGWDGFILSRDVIAALHREEV
LDASPTSRKGLMQAQEAFNLWHEESGLPYSHISRILSFTID