Protein Info for PGA1_c14610 in Phaeobacter inhibens DSM 17395

Annotation: GMP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00117: GATase
  • amino acids 10 to 197 (188 residues), 141.6 bits, E=6e-45
• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 10 to 199 (190 residues), 198 bits, E=9.4e-63
• PF07722: Peptidase_C26
  • amino acids 74 to 181 (108 residues), 26.9 bits, E=9.7e-10
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 212 to 522 (311 residues), 472.8 bits, E=5.1e-146
• PF02540: NAD_synthase
  • amino acids 217 to 270 (54 residues), 27.6 bits, 3.9e-10
• PF03054: tRNA_Me_trans
  • amino acids 225 to 262 (38 residues), 24.3 bits, 5.7e-09
• PF00958: GMP_synt_C
  • amino acids 431 to 521 (91 residues), 135 bits, E=1.9e-43

Best Hits

Swiss-Prot: 92% identical to GUAA_RUEPO: GMP synthase [glutamine-hydrolyzing] (guaA) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 92% identity to sil:SPO2109)

MetaCyc: 52% identical to GMP synthase monomer (Saccharomyces cerevisiae)
GMP synthase (glutamine-hydrolyzing). [EC: 6.3.5.2]

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• L-citrulline biosynthesis (8/8 steps found)
• L-glutamate and L-glutamine biosynthesis (7/7 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• superpathway of L-citrulline metabolism (10/12 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

See I7E0C4 at UniProt or InterPro

Protein Sequence (522 amino acids)

>PGA1_c14610 GMP synthase (Phaeobacter inhibens DSM 17395)
MTETSHDSLLIIDFGSQVTQLIARRLRELNVYCEIHPYQNVTMDFVREMAPKAVIFSGGP
DSVTREGSPRAPQEIFDLGVPILGICYGQQVMMHQLGGKVLSGHGTAEFGRAYVTPAVSS
LPLLDGWFADDSDREQVWMSHGDHVSEIAPGFEVYGTSPNAPFAITADVSRNFYAVQFHP
EVHHTPNGAKLYENFVKIAGFTGDWTMGAYREQAIQAIRDQVGDKQVICGLSGGVDSSVA
AILIHEAIGDQLTCVFVDHGLLRKNEAEEVVTMFRDNYNIQLIHADEQELFLGELDGQSD
PETKRKIIGKLFIDVFQKHANTIEGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGG
LPEKMGLKLVEPLRELFKDEVRALGRELGLPASFIGRHPFPGPGLAIRCPGEITREKLEI
LREADAIYIDQIRKHGLYDEIWQAFVAILPVRTVGVMGDGRTYDYACALRAVTSVDGMTA
DYYPFSHDFLGETATRIINEVKGINRCTYDITSKPPGTIEWE