Protein Info for PGA1_c14560 in Phaeobacter inhibens DSM 17395

Annotation: homoserine O-succinyltransferase MetA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01001: homoserine O-succinyltransferase
  • amino acids 1 to 300 (300 residues), 366.3 bits, E=7.3e-114
• PF04204: HTS
  • amino acids 2 to 298 (297 residues), 443 bits, E=2.3e-137

Best Hits

Swiss-Prot: 84% identical to METAA_RUEST: Homoserine O-acetyltransferase (metAA) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K00651, homoserine O-succinyltransferase [EC: 2.3.1.46] (inferred from 84% identity to sit:TM1040_1379)

MetaCyc: 59% identical to homoserine O-acetyltransferase (Agrobacterium fabrum C58)
Homoserine O-acetyltransferase. [EC: 2.3.1.31]

Predicted SEED Role

"Homoserine O-succinyltransferase (EC 2.3.1.46)" in subsystem Methionine Biosynthesis (EC 2.3.1.46)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (8/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (7/8 steps found)
• L-methionine biosynthesis III (4/4 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (8/10 steps found)
• L-homocysteine biosynthesis (2/2 steps found)
• L-methionine biosynthesis I (4/5 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (4/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Methionine metabolism
• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.31 or 2.3.1.46

Sequence Analysis Tools

See I7E0B8 at UniProt or InterPro

Protein Sequence (305 amino acids)

>PGA1_c14560 homoserine O-succinyltransferase MetA (Phaeobacter inhibens DSM 17395)
MPIKIPSDLPAYDVLTNEGVMVMSPDQAARQDIRPLRIGLLNLMPKKIQTENQFARLIGA
TPLQIDLSLIRMTEHQTRNTAAEHMAEFYRPFQEIKDQRFDGLIITGAPIEHLEFEDVTY
WDELCEVFDWTQTNVHSTFGVCWGGMAMINYFHGVKKHLLDHKVFGCFRHQNLDPASPYL
RGFSDDCVIPVSRWTEIRQSEIDARPGLRSLLGSQDAGPCLIEDPSHRALYIFNHFEYDS
DTLKQEYDRDVASGTPINVPMNYYPDDDPSRKPQNRWRSHAHLLYGNWINDIYQSTPFDM
AEIGH