Protein Info for Psest_1466 in Pseudomonas stutzeri RCH2

Annotation: transcriptional regulator, Spx/MgsR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01617: transcriptional regulator, Spx/MgsR family
  • amino acids 9 to 116 (108 residues), 96.1 bits, E=8.4e-32
• PF03960: ArsC
  • amino acids 11 to 117 (107 residues), 80 bits, E=6.3e-27

Best Hits

Swiss-Prot: 40% identical to Y103_HAEIN: Uncharacterized protein HI_0103 (HI_0103) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00537, arsenate reductase [EC: 1.20.4.1] (inferred from 94% identity to psa:PST_2838)

Predicted SEED Role

"FIG138056: a glutathione-dependent thiol reductase"

MetaCyc Pathways

• arsenate detoxification III (2/2 steps found)
• arsenic detoxification (bacteria) (2/4 steps found)
• arsenate detoxification I (3/6 steps found)
• arsenic detoxification (plants) (3/6 steps found)
• arsenic detoxification (yeast) (4/12 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.20.4.1

Use Curated BLAST to search for 1.20.4.1

Sequence Analysis Tools

See L0GKW8 at UniProt or InterPro

Protein Sequence (123 amino acids)

>Psest_1466 transcriptional regulator, Spx/MgsR family (Pseudomonas stutzeri RCH2)
MSGSDQRLCLYGIKACDTMKKARTWLDEHGLSYDFHDYKSAGIDRAHLEAWCNEHGWQTV
LNRAGTTFRKLDDAAKADLDQARAIELMLAQPSMIKRPVLDLGGRTLIGFKPDLYAAAVA
APN