Protein Info for PGA1_c14390 in Phaeobacter inhibens DSM 17395

Annotation: NifU homolog involved in Fe-S cluster formation

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 PF01592: NifU_N" amino acids 24 to 92 (69 residues), 23.3 bits, see alignment E=3.1e-09

Best Hits

KEGG orthology group: None (inferred from 75% identity to sit:TM1040_1395)

Predicted SEED Role

"Putative iron-sulfur cluster assembly scaffold protein for SUF system, SufE2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EWH9 at UniProt or InterPro

Protein Sequence (150 amino acids)

>PGA1_c14390 NifU homolog involved in Fe-S cluster formation (Phaeobacter inhibens DSM 17395)
MSGETDLIKLYSARILALAADIPHLDRLEAPDVTVKKRSPLCGSTVTVDLQVKEGAIAAF
GQDVKACALGQASAAVVGEVILGRTLPEVAQARQQLKAMLTEDGPVPDAPFDGFEVLIPA
REFKNRHASILLALDATYEAMQTHQEQTCA