Protein Info for HP15_1387 in Marinobacter adhaerens HP15

Annotation: ABC-type amino acid transport/signal transduction system, periplasmic domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF00497: SBP_bac_3" amino acids 47 to 259 (213 residues), 71.9 bits, see alignment E=2.8e-24

Best Hits

KEGG orthology group: None (inferred from 67% identity to maq:Maqu_1047)

Predicted SEED Role

"ABC-type amino acid transport/signal transduction system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJG5 at UniProt or InterPro

Protein Sequence (260 amino acids)

>HP15_1387 ABC-type amino acid transport/signal transduction system, periplasmic domain protein (Marinobacter adhaerens HP15)
MQNRYPRPVNATLGVLLLVLTALSSPVFASQDTSGEQKVFRFNISPNGYPPYLIGDQSQP
SGIMWDVVSEVAQRLGYRVIAEQIPRKRVDQMLLDGYIDATPRAREWADDPEKFLFTDAV
VDIEEVFFAPVKSSFHYESPDDLISKTIVTHLGYRYPLLEPYFEEGRIRRFDVSRDKDMF
TFVLHGDRFDAAVADRLVGKWILRNEGLRQHFDISNESISNYGFRLMLRKDWQSFASQFN
EELAKMKANGELDAILANYR