Protein Info for PGA1_c14380 in Phaeobacter inhibens DSM 17395

Annotation: ATP-dependent DNA helicase RecG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 696 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF17191: RecG_wedge" amino acids 19 to 174 (156 residues), 31.4 bits, see alignment E=4.1e-11 TIGR00643: ATP-dependent DNA helicase RecG" amino acids 33 to 658 (626 residues), 662.6 bits, see alignment E=3.5e-203 PF01336: tRNA_anti-codon" amino acids 68 to 137 (70 residues), 27.8 bits, see alignment E=5.8e-10 PF04851: ResIII" amino acids 270 to 425 (156 residues), 41.1 bits, see alignment E=5.4e-14 PF00270: DEAD" amino acids 271 to 429 (159 residues), 80.7 bits, see alignment E=3.2e-26 PF00271: Helicase_C" amino acids 473 to 582 (110 residues), 62.5 bits, see alignment E=1.3e-20 PF19833: RecG_dom3_C" amino acids 610 to 674 (65 residues), 43.9 bits, see alignment E=5.8e-15

Best Hits

KEGG orthology group: K03655, ATP-dependent DNA helicase RecG [EC: 3.6.4.12] (inferred from 81% identity to sit:TM1040_1397)

Predicted SEED Role

"ATP-dependent DNA helicase RecG (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DPZ7 at UniProt or InterPro

Protein Sequence (696 amino acids)

>PGA1_c14380 ATP-dependent DNA helicase RecG (Phaeobacter inhibens DSM 17395)
MSGRPEILFPLFAGLETLQGIGPKTAQHFAQIDIETPRDLLYSLPYSIVDRRRRDSIRGL
DYPTVATVEVTIGAHRPARNKGGAYRIHVSDAEEEFQLVFFHGRSRYLEAQLPEGARRVV
SGKLELFDGMAQMVHPDHMVPVAEAGDIPEFEPVYHLTHGVSQKTMFKAAQSALSRLPEL
QEWADPSQVRKEDWPTWQEALVAAHTPDGMDALAAEAPGRTRLAYDELFAHQLTLALARL
RDRALPGRSSLANGTLQSRVLGALPYRPTGAQARAIDEITADMARDARMNRLLQGDVGAG
KTLVAFMALLVAVEAGGQGVMMAPTEILARQHLEALRPLAETAGVVLEILTGRDKGRERA
AKCAALARGDIQILVGTHAVFQADVAFQDLRLAIVDEQHRFGVRQRMELAEKGKGADVLV
MTATPIPRSLALTQYGDMDVSMLDEKPPGRKPVKTAVISTERMQEVVSHLRGAIDEGRQC
YWVCPLVEESEVMDLTAAEERFKQLRAVLGEGVVGLVHGQMPAAEKDAAMAAFQAGETKV
LVATTVIEVGVNVPNASIMVIERAEIFGLAQLHQLRGRVGRGEAASTCLLLYQAPLSKGG
QKRLEILRETEDGFRIAETDLEMRGAGDVIGTAQSGLPRFRIADLDRQAGLMAVAQSDAR
ALLASDPDLSSPRGQAARVLLWLMKQDQAIRLISVG