Protein Info for Psest_1457 in Pseudomonas stutzeri RCH2

Annotation: FOG: Ankyrin repeat

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 PF12796: Ank_2" amino acids 27 to 113 (87 residues), 55.9 bits, see alignment E=1.3e-18 amino acids 91 to 164 (74 residues), 49.3 bits, see alignment E=1.5e-16 PF00023: Ank" amino acids 51 to 81 (31 residues), 26.8 bits, see alignment 1.1e-09 amino acids 84 to 113 (30 residues), 26 bits, see alignment 2.1e-09 amino acids 116 to 147 (32 residues), 25.7 bits, see alignment 2.6e-09 PF13637: Ank_4" amino acids 53 to 104 (52 residues), 35.5 bits, see alignment E=2.4e-12 amino acids 87 to 136 (50 residues), 42.8 bits, see alignment E=1.2e-14 PF13857: Ank_5" amino acids 70 to 121 (52 residues), 33.1 bits, see alignment E=1.4e-11 amino acids 103 to 154 (52 residues), 31.6 bits, see alignment E=4.2e-11 PF13606: Ank_3" amino acids 116 to 144 (29 residues), 23.3 bits, see alignment 1.5e-08

Best Hits

Swiss-Prot: 64% identical to Y3287_PSEAE: Putative ankyrin repeat protein PA3287 (PA3287) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06867, (no description) (inferred from 74% identity to psa:PST_2847)

Predicted SEED Role

"FOG: Ankyrin repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJ67 at UniProt or InterPro

Protein Sequence (174 amino acids)

>Psest_1457 FOG: Ankyrin repeat (Pseudomonas stutzeri RCH2)
MSQAPKPLPELDDATLAFAEQVFDSARGGDSARLGELLVQGMPANLCNHAGDSLLMLASY
HGHLDASRLLLQHGADPQLRNRRGHTPLAGAAFKGDLAMVKLLLEHGADVESRCEDGKTA
LMMAAMFNRVAIVEYLATQGADPRASDSNGATVLAAARMMGAADTEALLQRLGA