Protein Info for PGA1_c14310 in Phaeobacter inhibens DSM 17395

Annotation: acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase LpxA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 PF00132: Hexapep" amino acids 2 to 29 (28 residues), 28.3 bits, see alignment (E = 1.6e-10) TIGR01852: acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase" amino acids 4 to 256 (253 residues), 312.3 bits, see alignment E=1.1e-97 PF13720: Acetyltransf_11" amino acids 176 to 255 (80 residues), 70.9 bits, see alignment E=1.5e-23

Best Hits

Swiss-Prot: 68% identical to LPXA_PARDP: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA) from Paracoccus denitrificans (strain Pd 1222)

KEGG orthology group: K00677, UDP-N-acetylglucosamine acyltransferase [EC: 2.3.1.129] (inferred from 89% identity to sit:TM1040_1404)

MetaCyc: 47% identical to acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (Escherichia coli K-12 substr. MG1655)
Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase. [EC: 2.3.1.129]

Predicted SEED Role

"Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (EC 2.3.1.129)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.129)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.129

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E090 at UniProt or InterPro

Protein Sequence (261 amino acids)

>PGA1_c14310 acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase LpxA (Phaeobacter inhibens DSM 17395)
MTRIHPSAVIEEGAKIGADCVIGPFCLIGSDVVLGDRVELKSHVVVTGDTEIGEETVVFS
FAVLGEIPQDLKFKGERCKTVIGKRNRIREHVTVNAGTEGGGGVTRIGDDGLFMAGCHIA
HDAQVGDRVIVVNSAAVAGHCVLEDDVIIGGLSGIHQWVRIGHGAIVGAVTMVTNDVIPY
GLVQAPRGELDGLNLVGLKRRGVQRSDITALRAAFQMLAQGEGTFQERARRLGAESDSEY
VQEIVEFITGESDRSFLTPGG