Protein Info for Psest_1447 in Pseudomonas stutzeri RCH2

Annotation: Putative threonine efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 39 to 60 (22 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 151 to 174 (24 residues), see Phobius details amino acids 189 to 207 (19 residues), see Phobius details PF01810: LysE" amino acids 16 to 207 (192 residues), 130.7 bits, see alignment E=2.4e-42

Best Hits

KEGG orthology group: None (inferred from 89% identity to psa:PST_2855)

Predicted SEED Role

"COG1280: Putative threonine efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJ57 at UniProt or InterPro

Protein Sequence (211 amino acids)

>Psest_1447 Putative threonine efflux protein (Pseudomonas stutzeri RCH2)
MGDPLFWLVFFSAALALNLSPGPDLLYVISRTLSGGRRIGIISACGVCSGALVHVAFAAL
GISAILATSALAFTAVKYVGAAYLLYLGYQALRSAGSGTAPALKAAPRVSAWKAYRQGVL
VDLLNPKAAIFFMAFLPQFVRPEHGAVPLQLLVLGMLVVVVAIIVESALVLLAARATQTL
RNNPAVSQWLDRALGSVLIALGIRLGLSERI