Protein Info for Psest_1444 in Pseudomonas stutzeri RCH2

Annotation: Curli production assembly/transport component CsgF.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF10614: CsgF" amino acids 11 to 135 (125 residues), 97.6 bits, see alignment E=3.4e-32

Best Hits

KEGG orthology group: K04338, curli production assembly/transport component CsgF (inferred from 85% identity to psa:PST_2858)

Predicted SEED Role

"Curli production assembly/transport component CsgF" in subsystem Curli production

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GH03 at UniProt or InterPro

Protein Sequence (137 amino acids)

>Psest_1444 Curli production assembly/transport component CsgF. (Pseudomonas stutzeri RCH2)
MKQHTRKTLGALLGSLLLSAGASATELVYTPINPSFGGSPLNGAWLLGNAQAQNSKKDPD
ALDRSSLLGNQSTLDRFTSQLESRLLNDLLNDARDGKTGAITTDDFFVRVYNGDAGMLIV
EITDRLTGEMSEIIIGK