Protein Info for PGA1_c14240 in Phaeobacter inhibens DSM 17395

Annotation: phosphatidate cytidylyltransferase CdsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 34 to 52 (19 residues), see Phobius details amino acids 61 to 99 (39 residues), see Phobius details amino acids 105 to 125 (21 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 172 to 202 (31 residues), see Phobius details amino acids 241 to 259 (19 residues), see Phobius details PF01148: CTP_transf_1" amino acids 13 to 255 (243 residues), 166.1 bits, see alignment E=7.2e-53

Best Hits

KEGG orthology group: K00981, phosphatidate cytidylyltransferase [EC: 2.7.7.41] (inferred from 62% identity to sil:SPO1666)

Predicted SEED Role

"Phosphatidate cytidylyltransferase (EC 2.7.7.41)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.7.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EWG6 at UniProt or InterPro

Protein Sequence (263 amino acids)

>PGA1_c14240 phosphatidate cytidylyltransferase CdsA (Phaeobacter inhibens DSM 17395)
MSGAGRWADLMPRLISAVVMILVGGWAVWRGGVVFDLLIAAAGGGMIWELLRMVAPHRQG
VALPLGVLSMGAVLAAALMAGNWAVGLLLIPAILGAVALDIRRGIYLGFALWVVFAAYAF
IWMRSTLGLDWMVWLISVVVATDVAGYFAGKTFGGPKFWPRVSPKKTWSGTSAGWIAAAV
VGAIFAAQAGLGLGVVVLSVLVSMASQAGDVAESALKRKMSVKDSSALIPGHGGLFDRFD
GMLGAAAMVLLVLSLWGLPGGTM