Protein Info for PGA1_c14230 in Phaeobacter inhibens DSM 17395

Annotation: undecaprenyl pyrophosphate synthetase UppS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 TIGR00055: di-trans,poly-cis-decaprenylcistransferase" amino acids 22 to 248 (227 residues), 283.4 bits, see alignment E=5.9e-89 PF01255: Prenyltransf" amino acids 28 to 248 (221 residues), 278.8 bits, see alignment E=1.5e-87

Best Hits

Swiss-Prot: 51% identical to ISPT_RHIME: Isoprenyl transferase (uppS) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00806, undecaprenyl diphosphate synthase [EC: 2.5.1.31] (inferred from 84% identity to sit:TM1040_1412)

MetaCyc: 48% identical to ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific] (Escherichia coli K-12 substr. MG1655)
Di-trans,poly-cis-decaprenylcistransferase. [EC: 2.5.1.31]

Predicted SEED Role

"Undecaprenyl diphosphate synthase (EC 2.5.1.31)" (EC 2.5.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DPY6 at UniProt or InterPro

Protein Sequence (252 amino acids)

>PGA1_c14230 undecaprenyl pyrophosphate synthetase UppS (Phaeobacter inhibens DSM 17395)
MSQSTDTALAPSEGEPAPQRGPKHVAIIMDGNGRWAQARGRPRLFGHHAGAKRVREVVEC
CPALGVKYLTIFAFSTENWKRTQVEVAGLMSLFRRYISKEMKALSQRNVRVRFIGDRVRL
DKKLVTLMDQLEQETACNDGTHLTIALNYGSRDEVARATKRLAEDVAAGRLDPADVDEET
LPRYLDTHVLPDPDLVIRTSGEARISNFLLWQSAYAEYEFIDTLWPDFTADEMDRLCRSY
GQRDRRFGAVKT