Protein Info for PGA1_c14150 in Phaeobacter inhibens DSM 17395

Annotation: glutathione import ATP-binding protein GsiA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 695 PF00005: ABC_tran" amino acids 33 to 190 (158 residues), 95.5 bits, see alignment E=1.7e-30 amino acids 386 to 537 (152 residues), 109.5 bits, see alignment E=8.3e-35 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 240 to 329 (90 residues), 65.7 bits, see alignment E=4.8e-22 amino acids 587 to 678 (92 residues), 80.1 bits, see alignment E=1.5e-26 PF08352: oligo_HPY" amino acids 241 to 304 (64 residues), 55.4 bits, see alignment E=2.6e-18 amino acids 589 to 651 (63 residues), 55.5 bits, see alignment E=2.5e-18

Best Hits

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein K02032, peptide/nickel transport system ATP-binding protein (inferred from 90% identity to sit:TM1040_1420)

Predicted SEED Role

"Oligopeptide/dipeptide ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ELL0 at UniProt or InterPro

Protein Sequence (695 amino acids)

>PGA1_c14150 glutathione import ATP-binding protein GsiA (Phaeobacter inhibens DSM 17395)
MNKLAEYDGPILEIDKLSISFFTRLREIPAVMDFSVSVMPGEAVGLVGESGCGKSTVALG
VMQDLGKNGRIVGGSIKFKGRDLAEMSAEELRDVRGNEIAMIYQEPMASLNPAMKIGKQL
MEVPMIHEGVSKEEAYRRALEVVTDVRLPDPERMLNSFPHQLSGGQQQRIVIAMALMSKP
ALLILDEPTTALDVTVEAAVVELVKDLGKKYGTSMLFISHNLGLVLETCDRLCVMYSGEA
VERGSIHDVFDEMQHPYTQALFRSIPLPGADKNARPLVAIPGNFPLPHERPSGCNFGPRC
DYFEAGRCDAQDIPMVPVQGNDRHHTRCLRHDEIDWAAPITVGEQKEKPEVGEVVLKIDN
LRKYYEVSANALFDSGARKVVKANETLSFEARESETLAIVGESGCGKSTFAKVLMGLETA
TDGEIQLDGKNIEATPIEHRDTRTVSDVQMVFQNPFDTLNPSMTVGRQIVRALEIFGIGD
STAARRERMLELLDLVKLPRAFADRMPRQLSGGQKQRVGIARAFAGGARIVVADEPVSAL
DVSVQAAVTDLLMEIQRKEKTTLLFISHDLSIVRYLSDRVMVMYLGHVVELGTTDQVFAP
PYHPYTEALLSAVPIADTSVEKRHIVLEGDIPSAMNPPPGCPFQTRCRWKSKVADGLCER
EVPPVRTLDGGHQVKCHLSDADLTEMEPVIKIAAE