Protein Info for Psest_1430 in Pseudomonas stutzeri RCH2

Annotation: Choline dehydrogenase and related flavoproteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 PF00732: GMC_oxred_N" amino acids 129 to 305 (177 residues), 56.3 bits, see alignment E=4.1e-19 PF05199: GMC_oxred_C" amino acids 393 to 509 (117 residues), 71.9 bits, see alignment E=8.4e-24

Best Hits

KEGG orthology group: None (inferred from 63% identity to swd:Swoo_2930)

Predicted SEED Role

"Glucose-methanol-choline (GMC) oxidoreductase:NAD binding site" in subsystem Respiratory dehydrogenases 1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GL03 at UniProt or InterPro

Protein Sequence (525 amino acids)

>Psest_1430 Choline dehydrogenase and related flavoproteins (Pseudomonas stutzeri RCH2)
MATFAQDDDGVVVIIGSGAGGGTLANALAKQKIRSVVLEAGKRHTLEDIENDEWAMFKKI
SWLDKRQAAGGWHLTENNPTLPAWIVKGVGGSTVHWAGIALRFRDFEFKMQSINGDIAGA
NLLDWPVTLEEMAPWYEKAEKHMGVTGPSTGMDYHPWHNSFKVLATGAKRVGYKEILSGP
MAINTEPYDDRAACQQLGFCMQGCKMGAKWSTLYTDIPRAEASGYCEVRPQSMVLRIEHD
AKGRANAVVYADASGTIQRQKARVVCVAGNSIESPRLLLNSASAMFPDGLANSSGQVGRN
YMTHTTAGIFAVMPKPVNMHRGTTCAGVISDESYNDPSRGFVGGYRLEILALGLPFLSAF
LDPTPKGWGKQFTSRMEKYNHMSGVWLCGEDLPLESNRITLHDSEKDQYGLPIPVVTKSD
HPMDAAMRKHGVAATARCYEAAGATDIIELPPYPASHNMGTNRMSAMARDGVVNKWGQSH
DIPNLFVSDGSQFTTSGGQNPTLTIVALALRQAEQIGRLLNERAI