Protein Info for PGA1_c14100 in Phaeobacter inhibens DSM 17395

Annotation: 3-dehydroquinate synthase AroB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 transmembrane" amino acids 105 to 125 (21 residues), see Phobius details TIGR01357: 3-dehydroquinate synthase" amino acids 19 to 366 (348 residues), 356.3 bits, see alignment E=8.9e-111 PF13685: Fe-ADH_2" amino acids 22 to 138 (117 residues), 37.2 bits, see alignment E=4.6e-13 PF01761: DHQ_synthase" amino acids 75 to 185 (111 residues), 152.6 bits, see alignment E=4.9e-49 PF24621: DHQS_C" amino acids 188 to 337 (150 residues), 148.3 bits, see alignment E=2.3e-47

Best Hits

Swiss-Prot: 86% identical to AROB_RUEST: 3-dehydroquinate synthase (aroB) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K01735, 3-dehydroquinate synthase [EC: 4.2.3.4] (inferred from 86% identity to sit:TM1040_1432)

Predicted SEED Role

"3-dehydroquinate synthase (EC 4.2.3.4)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Type IV pilus (EC 4.2.3.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ELK4 at UniProt or InterPro

Protein Sequence (375 amino acids)

>PGA1_c14100 3-dehydroquinate synthase AroB (Phaeobacter inhibens DSM 17395)
MEQAMLERSVHVALGERAYDVVIGPDLLADAGARLAPMLRRPKVAVLTDETVAAHHLEGL
RAGLASAGIEMDALALPPGESTKAWPQFSRAVEWLLEQKVERGDIVIAFGGGVIGDLAGF
AAAVLRRGVRFVQIPTSLLAQVDSSVGGKTGINAPQGKNLIGAFHQPSLVLADTALLGTL
TPRDFLAGYGEVVKYGLLGDAEFFEWLEAQGPALAAGDMAARVEAVTRSVQMKADIVVRD
ETEQGDRALLNLGHTFCHALEAATGYGDRLLHGEGVAIGCALAFELSARLGLCSQEDPSR
VRAHLKAMGMKTDLADIPGELPDAEALLALMGQDKKVVDGQLRFILARGIGQAFVTGDVP
QAAVLDVLRDALAQS