Protein Info for PGA1_c13990 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): Novel Xylose regulator from LacI family
Rationale: Specifically important in carbon source D-Xylose. Also see expression evidence (PMC4148808). (SEED_correct)
Original annotation: putative transcriptional regulator, iacl family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 PF00356: LacI" amino acids 5 to 49 (45 residues), 52.5 bits, see alignment 3.4e-18 PF13407: Peripla_BP_4" amino acids 64 to 322 (259 residues), 134.6 bits, see alignment E=4.8e-43

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 46% identity to avi:Avi_3834)

Predicted SEED Role

"Novel Xylose regulator from LacI family" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EWE4 at UniProt or InterPro

Protein Sequence (353 amino acids)

>PGA1_c13990 Novel Xylose regulator from LacI family (Phaeobacter inhibens DSM 17395)
MGKPTLHDVAAAAGVSYATADRVLNNRGGVAKKSQDRVRAAIADLGYQRDITAANLSRRR
RYRFAVLMPAAQEGFFATLHADLEQEVAARSQARQQITLTQVPPFDAAALTCALEACAAE
GYDGVCLVAVQDPSVDAALTGLRAQGVAVVTLVADSAAQARDTYVGIDNRRAGRTAGDLM
RLAHRGSAASLGQILPITGSLNARDHADRYAGFCDVVSADLHILPPLETGDDPEILEQAL
RRTLRANPNITGIYNLGAGIPGLISALAAIQPDDRPVVISHELCPATRDAVAHGLIDAVI
DQKPAQEITAALAALVALSDGQSVDPLAGQITPAVHFKHNMPPQSAVGPEEGA