Protein Info for PGA1_c13920 in Phaeobacter inhibens DSM 17395

Annotation: cyclopropane-fatty-acyl-phospholipid synthase Cfa

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 PF02353: CMAS" amino acids 127 to 396 (270 residues), 294.6 bits, see alignment E=2.8e-91 PF01728: FtsJ" amino acids 172 to 227 (56 residues), 27.1 bits, see alignment 1.5e-09 PF13489: Methyltransf_23" amino acids 176 to 334 (159 residues), 45.9 bits, see alignment E=2.2e-15 PF13847: Methyltransf_31" amino acids 184 to 285 (102 residues), 39.7 bits, see alignment E=1.7e-13 PF13649: Methyltransf_25" amino acids 189 to 283 (95 residues), 61.6 bits, see alignment E=3.9e-20 PF08242: Methyltransf_12" amino acids 190 to 284 (95 residues), 50.1 bits, see alignment E=1.5e-16 PF08241: Methyltransf_11" amino acids 190 to 285 (96 residues), 50.9 bits, see alignment E=8.4e-17

Best Hits

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 73% identity to jan:Jann_1990)

MetaCyc: 71% identical to cis-vaccenate 11-methyltransferase (Cereibacter sphaeroides)
2.1.1.-

Predicted SEED Role

"Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79), plant type" (EC 2.1.1.79)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.79

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DPV8 at UniProt or InterPro

Protein Sequence (401 amino acids)

>PGA1_c13920 cyclopropane-fatty-acyl-phospholipid synthase Cfa (Phaeobacter inhibens DSM 17395)
MALTTTDGQANLPRYFAAIFDQLHALEVGQLDIHLPDGRVFRVSGQGPGPAADLHIHNLD
CFARLIREGDLGFSDAYLDGWWSTSDLQAFMDLIHLGSDTVYDGFPGRGLIRAYEQFRFW
LQRNHRAQAKANISYHYDLGNAFYGLWLDDTMTYSSALFKTGQESLEAAQTAKYASMVDQ
MGVKPGDHVLEVGCGWGGFAEYAARERGLRVTGLTISEEQLKYARERIEKAGLSDQVKLR
MQDYRDCEGTFDGIASIEMFEAVGEKYWPAYFNMVRDRLRPGGQATLQIITVADRRWTVY
KRGVDFIQKHIFPGGMLPAPKILRQQVELAGLQVMKSLEFGDSYDQTLRRWHATFNNRWD
EIAAMGFDDRFRKMWNFYLTSCAAAFKAETCDVTQITLAHR