Protein Info for PGA1_c13910 in Phaeobacter inhibens DSM 17395

Annotation: deoxyribodipyrimidine photo-lyase PhrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 transmembrane" amino acids 26 to 43 (18 residues), see Phobius details PF00875: DNA_photolyase" amino acids 12 to 162 (151 residues), 161 bits, see alignment E=2.5e-51 PF03441: FAD_binding_7" amino acids 275 to 472 (198 residues), 226.5 bits, see alignment E=2.2e-71

Best Hits

KEGG orthology group: K01669, deoxyribodipyrimidine photo-lyase [EC: 4.1.99.3] (inferred from 67% identity to sit:TM1040_1441)

Predicted SEED Role

"Deoxyribodipyrimidine photolyase (EC 4.1.99.3)" (EC 4.1.99.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EYV5 at UniProt or InterPro

Protein Sequence (479 amino acids)

>PGA1_c13910 deoxyribodipyrimidine photo-lyase PhrB (Phaeobacter inhibens DSM 17395)
MTDEKPSNAPIIWWVRRDLRLADNPALAAAVAAGVPVIPVFIFETLDEDLGAAPRFRLGL
GLAHLAKELEQRGARLILRRGPAQEVLTQLITETGAGAVHWTRAYDPQAIARDTGIKEQL
KGQGIAAKSFGGHLLFEPWTVETKTGGMYRVYSPYWKSVRDRDVDGLIAAPSRIPAPAHW
PTSDDLDSWQMAAAMRRGADVVAQYCRVGEDAAQERLAEFLDTRVADYKQDRDFPAVDAT
SGLSENLAWGEISPRRMWHHGLEARRAGKSGAEHFLKEIVWREFAYHLMFHTPHILTRNW
RPEWEHFNWSERDDDKVDAWRRGQTGYNFVDAAMRELYVTGKMHNRARMIVASFLTKHML
THWRIGQQWFEECLVDWDPASNAMGWQWVAGSGPDASPFFRIFNPDGQLEKFDPKGRYQS
AWIAEGQANPPQTALDFYRATPLSWELSPQDTRAEPFLDLKEGRARALEAYGQRELPDD