Protein Info for PGA1_c13900 in Phaeobacter inhibens DSM 17395

Annotation: putative cysteine desulfurase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 PF00266: Aminotran_5" amino acids 25 to 241 (217 residues), 145.4 bits, see alignment E=2.4e-46 amino acids 302 to 399 (98 residues), 25.8 bits, see alignment E=5.3e-10 PF00155: Aminotran_1_2" amino acids 68 to 196 (129 residues), 34.4 bits, see alignment E=1.5e-12

Best Hits

KEGG orthology group: None (inferred from 83% identity to sil:SPO1916)

Predicted SEED Role

"Aminotransferase involved in DMSP breakdown"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E040 at UniProt or InterPro

Protein Sequence (409 amino acids)

>PGA1_c13900 putative cysteine desulfurase (Phaeobacter inhibens DSM 17395)
MALDIDYVRSQFPAFSAPNLQGQAFFENAGGSYTCQPVINRLTRFYTERKVQPYAPYEAS
TLAGAEMDEARHRLAKIMGVDTDELSFGPSTTQNTYVLAQAFRQLLSPGEAIIVTNQDHE
ANSGPWRRLADAGIEVREWQIDPQTGHLDPGDLENLLDEKVRLVCFPHCSNVVGELNPVT
EITALAHAAGAFVCVDGVSYAPHGLPNVGELGPDIYLFSAYKTYGPHQGLMVIRRALGEL
LPNQGHFFNGDTLYKRFTPAGPDHAQVAACAGMADYIATLAHHHGGPLTEGAAQGAFVHD
LMRAHEVELLQPLLDMVKDRNDLRLIGPSDANNRAPTVALALDRSGEAVAAELAEHGIMA
GGGDFYALRALNAMGVSTSDGVLRLSFTHYTSKKEMTQLMEALDRVLSK