Protein Info for Psest_1406 in Pseudomonas stutzeri RCH2

Annotation: His Kinase A (phosphoacceptor) domain./Response regulator receiver domain./Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 567 PF00512: HisKA" amino acids 197 to 259 (63 residues), 33.5 bits, see alignment E=5.3e-12 PF02518: HATPase_c" amino acids 302 to 416 (115 residues), 73.6 bits, see alignment E=2.6e-24 PF00072: Response_reg" amino acids 442 to 551 (110 residues), 71.2 bits, see alignment E=1.2e-23

Best Hits

KEGG orthology group: None (inferred from 89% identity to psa:PST_2886)

Predicted SEED Role

"Sensory box sensor histidine kinase/response regulator (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJK9 at UniProt or InterPro

Protein Sequence (567 amino acids)

>Psest_1406 His Kinase A (phosphoacceptor) domain./Response regulator receiver domain./Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase. (Pseudomonas stutzeri RCH2)
MTTPTKREGPIVVVYAPIGRDGPASAELLSRSGMDAVVCHSVDEVLRRAETDADAVFIAE
EGLFGQDLQALATWVDQQPAWSDFPFVVLTSKHQQPAVAAWRQRMVAALRNVSLLERPVQ
SITLTSAVKAALRGRHRQYEVRALLEARERASNQLEALVVERTSELEKANQELRTQMAER
AQIEETLRQAQKIEAIGQLTGGIAHDFNNLLMVISGGLDMLDRRADPARRERLMDGMRQA
AQRGTALTRQLLAFSRRQSLEPESVDLVLRIGRMRELLDRSLSGDVHVEVQFEPDLWPVE
VDPGELELVVLNLAVNARDAMPDGGSILIEASNAPGEAVLGITGDFVRLTVTDSGTGIPE
EVRTRVFDPFFTTKEIGKGSGLGLAQVYGFARQSGGSVWIESECDRGTSVIMLLPRSARV
PEQPDGERPAEDDSSDASAGTVLLVDDDEEVAALVGEMLEHLGYRVTHAASATDALGALQ
DGCQVDIVFSDVMMPGGMNGVELAREIRTRALGVPVLLTSGYAEAAQQSAAAEGVHVLAK
PYRLEELATSLREAIESAVFADPVRQG