Protein Info for PGA1_c13840 in Phaeobacter inhibens DSM 17395

Annotation: putative transcriptional regulator, AraC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 34 to 54 (21 residues), see Phobius details amino acids 60 to 82 (23 residues), see Phobius details amino acids 93 to 110 (18 residues), see Phobius details amino acids 116 to 134 (19 residues), see Phobius details amino acids 154 to 177 (24 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details PF12833: HTH_18" amino acids 257 to 335 (79 residues), 75.8 bits, see alignment E=2.7e-25 PF00165: HTH_AraC" amino acids 296 to 335 (40 residues), 30.9 bits, see alignment 2.3e-11

Best Hits

KEGG orthology group: None (inferred from 51% identity to rec:RHECIAT_CH0002740)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ELH9 at UniProt or InterPro

Protein Sequence (355 amino acids)

>PGA1_c13840 putative transcriptional regulator, AraC family (Phaeobacter inhibens DSM 17395)
MIFIPIEFMFSAQMLFLFIHVVRNDDTANKNRPFLILILLSAVQSFLLGLRWGYDVEATS
YIVPILATLVPALVYAGVLNVVERDRWPMAPRLAVHYLPTVLVIGLTFVWREAVDIVVVV
TFLSYAVVILRLLLPGTDALGITPLDGAESTYRAIFFAALSLLSFALLDTILFLSFMWKH
VEYVPSVILFANFAALVMLGLAATLASNSRSAPETPQQPRRIEEEEELSGSATIVRIEEL
MNEGKVYRDANLNLERLARKALIPSRQISQAINRSAGMNVSQYVNGYRIAEACDLLQATR
RSVTDIMFDVGFQTKSNFNREFRRVTGMTPQAWRNKYTPGCDGAEVASNPSCAPQ