Protein Info for HP15_1334 in Marinobacter adhaerens HP15

Updated annotation (from data): Error-prone polymerase for DNA repair (imuB or polY like)
Rationale: Conserved and specific phenotype: important for resisting cisplatin. Related to imuB from Caulobacter. Also similar to PA0670, which is induced by the SOS response, even though it does not seem to have mutant phenotypes related to DNA repair.
Original annotation: conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00817: IMS
  • amino acids 25 to 147 (123 residues), 55.4 bits, E=3.4e-19

Best Hits

KEGG orthology group: K14161, protein ImuB (inferred from 71% identity to maq:Maqu_0974)

Predicted SEED Role

"DNA polymerase-like protein PA0670" in subsystem DNA repair, bacterial

Sequence Analysis Tools

See E4PIM3 at UniProt or InterPro

Protein Sequence (472 amino acids)

>HP15_1334 Error-prone polymerase for DNA repair (imuB or polY like) (Marinobacter adhaerens HP15)
MLWLYLHFPHLVLDHIRRTREDEGALVVVEGSGQKVIQACPDARSQGIRSGMRLKTAISL
APDLGMVRADETQEARILEDQARWLYRYAAHIVLVPPDGLLAEIGSLQKLYGGLPAVWQT
VEQGLNERQLNAWIGIGYTPLAARLIARAGKGECTADKGHILRSLSQMPLLAAEFNEKAC
TRLRRLGLNTLGEVFDLPPGELARRLSPELLAYIQKIQGTRPDPRTPWQPPHSFRQQADF
VQEIEHTQGLLFPLQRMLVELEEDLCWRQQDTDSLRLVLKHRHAEPTRLQIRTSGPEHRA
DHFLNLVRLRLEQHSLSAPVISMVLLVKRFLSREAPSGQDLLGETQDLNEAWHTLISRLQ
ARLGDQALRQLSPQADHRPERAWSASEVLRKTGTPLVPAAELPRRPLWLLKGPQPLTEAP
VTWFSGPERISGGWWDGQRVHRDYYIAQLSSGQLAWVFRDAREGWFVHGWFG