Protein Info for HP15_1330 in Marinobacter adhaerens HP15

Annotation: sodium ion-translocating decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01195: sodium pump decarboxylases, gamma subunit
  • amino acids 3 to 81 (79 residues), 59.8 bits, E=1.5e-20
• PF04277: OAD_gamma
  • amino acids 7 to 78 (72 residues), 70.5 bits, E=7.9e-24

Best Hits

Swiss-Prot: 36% identical to OADG_HAEDU: Oxaloacetate decarboxylase gamma chain (oadG) from Haemophilus ducreyi (strain 35000HP / ATCC 700724)

KEGG orthology group: K01573, oxaloacetate decarboxylase, gamma subunit [EC: 4.1.1.3] (inferred from 92% identity to maq:Maqu_0970)

Predicted SEED Role

"Oxaloacetate decarboxylase gamma chain (EC 4.1.1.3)" in subsystem Na+ translocating decarboxylases and related biotin-dependent enzymes or Pyruvate metabolism I: anaplerotic reactions, PEP (EC 4.1.1.3)

MetaCyc Pathways

• methylgallate degradation (2/6 steps found)
• protocatechuate degradation I (meta-cleavage pathway) (3/8 steps found)
• superpathway of vanillin and vanillate degradation (3/10 steps found)
• syringate degradation (3/12 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.3

Use Curated BLAST to search for 4.1.1.3

Sequence Analysis Tools

See E4PIL9 at UniProt or InterPro

Protein Sequence (83 amino acids)

>HP15_1330 sodium ion-translocating decarboxylase (Marinobacter adhaerens HP15)
MNDLMSQAVDLMIAGMGFVFVFLIILVFATLLMSKLIGRFAPPEPATPAKTPRAKPKAPA
SVDPDTAEAIKKAIAQFRSRHKK