Protein Info for Psest_1397 in Pseudomonas stutzeri RCH2

Annotation: ABC-type nitrate/sulfonate/bicarbonate transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 signal peptide" amino acids 1 to 50 (50 residues), see Phobius details transmembrane" amino acids 87 to 107 (21 residues), see Phobius details amino acids 118 to 141 (24 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 197 to 223 (27 residues), see Phobius details amino acids 243 to 264 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 99 to 267 (169 residues), 104.4 bits, see alignment E=3.2e-34

Best Hits

Swiss-Prot: 38% identical to RIBX_CHLAA: Riboflavin transport system permease protein RibX (ribX) from Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 94% identity to psa:PST_2901)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGT3 at UniProt or InterPro

Protein Sequence (278 amino acids)

>Psest_1397 ABC-type nitrate/sulfonate/bicarbonate transport system, permease component (Pseudomonas stutzeri RCH2)
MSSPTISAAKSSRAMPTIKPKALHLKAQADRFAPWLALLVLLLVWEAACRLLKLPSFVLP
SPSAIFAATQKVGLGTWAEHIFATLRVTLMGYGLSILIGIPLAIALASSRVMSRTLYPLL
VIVQSTPIVAVAPIIVVVMGAGDLPRVFITFLIAFFPIVVSCVTGLLATPEELVELSRSL
GASKAREYRNIRLPYAIPHLFSALRISITLAVIGAVVAEFVAAEKGLGYFINFSTSMFQV
PQAFAALMMLVVISLVLFHLIGLLQKVCFPWSLPKGGH