Protein Info for Psest_1395 in Pseudomonas stutzeri RCH2

Annotation: Short-chain alcohol dehydrogenase of unknown specificity

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF00106: adh_short" amino acids 7 to 198 (192 residues), 185.7 bits, see alignment E=1.4e-58 PF08659: KR" amino acids 9 to 171 (163 residues), 62.5 bits, see alignment E=9.9e-21 PF01370: Epimerase" amino acids 9 to 148 (140 residues), 21.9 bits, see alignment E=2.1e-08 PF13561: adh_short_C2" amino acids 13 to 223 (211 residues), 145.4 bits, see alignment E=4.3e-46

Best Hits

Swiss-Prot: 51% identical to Y1627_STAS1: Uncharacterized oxidoreductase SSP1627 (SSP1627) from Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

KEGG orthology group: None (inferred from 96% identity to psa:PST_2903)

MetaCyc: 43% identical to clavulanate dehydrogenase subunit (Streptomyces clavuligerus)
RXN-8893

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIY3 at UniProt or InterPro

Protein Sequence (245 amino acids)

>Psest_1395 Short-chain alcohol dehydrogenase of unknown specificity (Pseudomonas stutzeri RCH2)
MSNINGKVVLITGASSGIGEATARLLAAQGATVVLGARRLDRLEKLVAEIDESGGIAACR
ALDVTSREDTQAFVDFAEQRFGRVDVIVNNAGVMPLSPLDALKVDEWNRMIDVNIRGVLH
GIAAGLPLMQRQRAGQFVNIASIGAYAVSPTAAVYCATKYAVRAISEGLRQEVGGDIRVT
LVSPGVTESELAESISDDSARSAMDDFRRIAIPAEAIARAIAYAIDQPADVDVSELVVRP
TASLY