Protein Info for Psest_1386 in Pseudomonas stutzeri RCH2

Annotation: Na+/H+-dicarboxylate symporters

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 42 to 67 (26 residues), see Phobius details amino acids 79 to 104 (26 residues), see Phobius details amino acids 146 to 170 (25 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 218 to 248 (31 residues), see Phobius details amino acids 311 to 345 (35 residues), see Phobius details amino acids 355 to 377 (23 residues), see Phobius details PF00375: SDF" amino acids 4 to 404 (401 residues), 406.8 bits, see alignment E=5.2e-126

Best Hits

KEGG orthology group: None (inferred from 98% identity to psa:PST_2912)

Predicted SEED Role

"Proton/glutamate symport protein @ Sodium/glutamate symport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJH4 at UniProt or InterPro

Protein Sequence (409 amino acids)

>Psest_1386 Na+/H+-dicarboxylate symporters (Pseudomonas stutzeri RCH2)
MPSLNLQILIAACLGVAIGWLTGTLPTDAPVREGVLYASTLAGSIFIGLLKMVLIPLIFT
SIVVGVANLQAHHQVHRVWGGALVYFTLTTSAAMLVALVAANLFKPGAGLSLDLFAEAMN
DFEARQLTLPEFFLHFFANLFQNPFAALANGSILAVVVFAMFIGIALVAGGDRYRNILVV
LQEFLELMMRIISWIMRLAPLGILALLIKLVAEQDVALLSAVGGFIALVFATTLFHGTVV
LPGILFLATGKSPLWFFRGTREALITAFATSSSAATLPISLRCAEDNLKVRPGIAGFVLP
LGATMNMDGTALYEAAAALFVANLMGIELSLAQQAVVFFTAMIASTGAPGIPSAGMVTMV
MVLQAVGLPAEAVAILLPIDRLLDTVRTAVNVEGDIIGSVVVQRFADRA