Protein Info for PGA1_c13680 in Phaeobacter inhibens DSM 17395

Annotation: Prolyl oligopeptidase family.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 173 to 192 (20 residues), see Phobius details PF00561: Abhydrolase_1" amino acids 107 to 211 (105 residues), 48.9 bits, see alignment E=1.5e-16 PF12146: Hydrolase_4" amino acids 108 to 205 (98 residues), 35.5 bits, see alignment E=1.4e-12 PF12697: Abhydrolase_6" amino acids 109 to 297 (189 residues), 44.4 bits, see alignment E=6.5e-15 PF00326: Peptidase_S9" amino acids 151 to 275 (125 residues), 24.3 bits, see alignment E=4.1e-09

Best Hits

Predicted SEED Role

"probable hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EWB9 at UniProt or InterPro

Protein Sequence (316 amino acids)

>PGA1_c13680 Prolyl oligopeptidase family. (Phaeobacter inhibens DSM 17395)
MLYELALPGLLAQGGYRWLRAVRRSAPQQPALRLRTARSRLRRLEIDLLDRLSPTLAARL
LLRRFHQNQSETPTPIPTNRDQQLITASDAFHCSGIYVRQFGPTNGPRVLLVHGWNADGR
MMLPLAQDLADRGFRVDVPDLPGAGKSRGPVRSFVAVARRLKNMCPQDQPYEVLAGHSAG
GLMAMIALGLGLKARRLVTLSAPSSLDRLMELYLRFTGQPAKTGAALMRRYAKTCGRELA
EIGPVECRETTLPMLVIHAQHDWQVPPAEAQRICAARDGLMPIYLRNCNHRSVLHHPELL
GLMERFFHETSNAGSR