Protein Info for HP15_135 in Marinobacter adhaerens HP15

Annotation: von Willebrand factor, type A-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 590 PF00092: VWA" amino acids 492 to 558 (67 residues), 28 bits, see alignment E=3.6e-10

Best Hits

KEGG orthology group: None (inferred from 66% identity to maq:Maqu_4064)

Predicted SEED Role

"Plasmid associated gene product APECO1_O1R37"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJ80 at UniProt or InterPro

Protein Sequence (590 amino acids)

>HP15_135 von Willebrand factor, type A-like protein (Marinobacter adhaerens HP15)
MNQRQSALERALPIVAAAYGEQFGVRVVLSGSDAMTDGKTIVLPMLDNMSEMKDVLFGYL
SHEAAHIRESSFDTLKKCRSEIEKSMTNLIEDIRIERAIQHAFPGTQFTLEAMENYIHGR
GWTPVPTTAESEASQLFRYLYHRLYGEFLDRQVYQPLIPESLKVLEQTFPRGFFVRLDGL
LAKYMMSMTTSDDALKVARAILKALKDAEKEEEQERKSGQDSDSSQPPDPSPDGQGDSSD
PNSNSDSSSSENGDNQGDSSPEAADQTEGPSDASGEQSMSDQDSAGDQAESDSSSDDSSD
AGAGGTYERVMSEQDMPTNPGQQLKEDLCSQAREDQSGKSFEIDTGVGQDMRNGNGDTSE
LQAGILTSSSIRSRLLGLLQAETRQRQWLHDRGRRVDGRRLSRLAAGDTRVFIQRDEHKR
PETSVHVLLDTSGSMSQRQEIANQATVSLALAISTIPKCDIAVSMFPGCGGSVSPMIHRG
QPVRPNLGRFLVSSGGGTPLAEAMLYAARELSASHKPRQVLIVITDGSPNNGHAVNYLLD
LMKHQIDTYAIGIGSNAVKSYFGNWTVINDVRELQSALFRIAGNVLDLDP