Protein Info for PGA1_c13550 in Phaeobacter inhibens DSM 17395

Annotation: putative chromate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 25 to 42 (18 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 92 to 115 (24 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 156 to 184 (29 residues), see Phobius details amino acids 204 to 227 (24 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 285 to 303 (19 residues), see Phobius details amino acids 306 to 331 (26 residues), see Phobius details amino acids 346 to 370 (25 residues), see Phobius details amino acids 379 to 430 (52 residues), see Phobius details PF02417: Chromate_transp" amino acids 21 to 184 (164 residues), 145.6 bits, see alignment E=7.1e-47 amino acids 234 to 405 (172 residues), 102.3 bits, see alignment E=1.5e-33 TIGR00937: chromate efflux transporter" amino acids 28 to 405 (378 residues), 201.9 bits, see alignment E=1.2e-63

Best Hits

KEGG orthology group: K07240, chromate transporter (inferred from 64% identity to sil:SPO1908)

Predicted SEED Role

"Chromate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EYS4 at UniProt or InterPro

Protein Sequence (432 amino acids)

>PGA1_c13550 putative chromate transporter (Phaeobacter inhibens DSM 17395)
MTDISPDPKVQPQAHAITMADLIRVFGRIGLMSFGGPAAQIALMHKELVEDRPWLSEAGF
LRALSFCMMLPGPEAMQLATYAGWRLRGAAGGVLAGLLFVLPGALVIAALVFLYVNFGTQ
PLVQAGFLGIKTAVVAIVLQALQRLGKKALHGVTDLALAAFGFLALFLFALPFPLVLLTA
ALLGSLRVRSTENEPAALPPAAAGPVWVTLLLWGGLWLLPLGALSLFGPQLLADIGWFFA
KLAVVTFGGAYAVLAYMSQTVVAQYQWIETGQMIDALGLAETTPGPLILVTQFVAMLAGA
LASGTWMALAAGLVALWATFMPCFLWIFLAAPHVERIASHPRLGAALRAITAVVVGVILN
LSVWFLLHVLFRETVTLELPAISLMLPVMASLDVSAALLVLAAPVVALACAGRLALILPI
MAGLGIAMAQII