Protein Info for Psest_1372 in Pseudomonas stutzeri RCH2

Annotation: Methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 539 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 189 to 209 (21 residues), see Phobius details PF02203: TarH" amino acids 1 to 171 (171 residues), 33.6 bits, see alignment E=7.2e-12 PF12729: 4HB_MCP_1" amino acids 5 to 183 (179 residues), 42.5 bits, see alignment E=1.1e-14 PF00672: HAMP" amino acids 208 to 259 (52 residues), 54.7 bits, see alignment 2.1e-18 PF00015: MCPsignal" amino acids 321 to 505 (185 residues), 144.7 bits, see alignment E=5.2e-46

Best Hits

Swiss-Prot: 66% identical to NAHY_PSEPU: Methyl-accepting chemotaxis protein NahY (nahY) from Pseudomonas putida

KEGG orthology group: None (inferred from 91% identity to psa:PST_2923)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKS6 at UniProt or InterPro

Protein Sequence (539 amino acids)

>Psest_1372 Methyl-accepting chemotaxis protein (Pseudomonas stutzeri RCH2)
MMQQLTIRARLLILVGAMLTACLVIGLTGLNAQQRSVAGLNTVYLDRVVPLRDLKLIADL
YAVKIVDTTHKTRSGMLTYGQARDDVRNARGEIRRLWGDFMSTKLIEAERRVVTRLEGLM
KAADAPLDDLERILDRHSEKRLAAFVVNDLYPLIDPISEGFSELIHLQLGEAKAEYDEAL
ALYERNRVLNIGLLLALLIGGGLFAMVLLRSISRPLEELKQAAASVAAGDLSRTIACRGK
DEITEVQQSIRQMQQTLRDTLQDIQGSATQLASAAEELHAVTQHTAQGIHQQNEEVQMAA
TAVTEMSAAVDEVAGNANRTSDASRDAETVADDGRRQVTATRQTIDQLSEKLQQTAGTVT
RLAEEAASIGQVVDVIRAIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRNLAQRTQS
STQEIERMIGAIQSATEQSVRDMQQSSEFATRSQTMAGEADQALGLIAERVGQINEMNLV
IASAAEEQAQVAREVDRNLVAIRDISEQSATGAQQTSVASDELARLATHLNQLVGRFRL