Protein Info for PGA1_c13520 in Phaeobacter inhibens DSM 17395

Annotation: fumarate hydratase class II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 TIGR00979: fumarate hydratase, class II" amino acids 5 to 461 (457 residues), 730.4 bits, see alignment E=4.1e-224 PF00206: Lyase_1" amino acids 13 to 342 (330 residues), 367.2 bits, see alignment E=8.2e-114 PF10415: FumaraseC_C" amino acids 408 to 460 (53 residues), 78.9 bits, see alignment 3e-26

Best Hits

Swiss-Prot: 70% identical to FUMC_RHIME: Fumarate hydratase class II (fumC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01679, fumarate hydratase, class II [EC: 4.2.1.2] (inferred from 96% identity to sit:TM1040_1452)

MetaCyc: 67% identical to fumarate hydratase monomer (Homo sapiens)
Fumarate hydratase. [EC: 4.2.1.2]

Predicted SEED Role

"Fumarate hydratase class II (EC 4.2.1.2)" in subsystem TCA Cycle (EC 4.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EWA2 at UniProt or InterPro

Protein Sequence (464 amino acids)

>PGA1_c13520 fumarate hydratase class II (Phaeobacter inhibens DSM 17395)
MSDTRTETDSFGPLEVPANKYWGAQTQRSIMNFPIGWEKQPVAIVRALGVIKQACAMANK
ASGKLDARIGDAVIQAAGEVIEGKFDDNFPLVVWQTGSGTQSNMNSNEVIANRAIEILGG
VIGSKDPVHPNDHCNMGQSSNDTFPTAMHIATAMMVRDVLVPGLTKLAEGLEAKAEAFKD
IIKIGRTHTQDATPLTLGQEFGGYAHQIRQGLARVEAAMPGIYELAQGGTAVGTGLNTQK
GWGETVAANMAEITGLPFVTAPNKFEALAAHDAMVFLSGALATIAGSCYKIANDIRFLGS
GPRSGLGELILPENEPGSSIMPGKVNPTQAEALTQVAAHVMGNDAAIKFAGSQGHFELNV
YNPMMSYNLLQSIQLLGDAADSFTERMLNGIEANEPRIDKLMKESLMLVTALAPTIGYDN
ATKVAKTAHKNGTTLKEEAIALGFVDEASFDAVVRPEQMIGPKD