Protein Info for HP15_1305 in Marinobacter adhaerens HP15

Annotation: nicotinate-nucleotide pyrophosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00078: nicotinate-nucleotide diphosphorylase (carboxylating)
  • amino acids 15 to 277 (263 residues), 305.2 bits, E=1.8e-95
• PF02749: QRPTase_N
  • amino acids 23 to 111 (89 residues), 85.1 bits, E=2.8e-28
• PF01729: QRPTase_C
  • amino acids 113 to 277 (165 residues), 188.9 bits, E=6.3e-60

Best Hits

Swiss-Prot: 73% identical to NADC_PSEAE: Nicotinate-nucleotide pyrophosphorylase [carboxylating] (nadC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00767, nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC: 2.4.2.19] (inferred from 78% identity to maq:Maqu_0952)

MetaCyc: 55% identical to quinolinate phosphoribosyltransferase (decarboxylating) (Escherichia coli K-12 substr. MG1655)
Nicotinate-nucleotide diphosphorylase (carboxylating). [EC: 2.4.2.19]

Predicted SEED Role

"Quinolinate phosphoribosyltransferase [decarboxylating] (EC 2.4.2.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.4.2.19)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• NAD de novo biosynthesis I (6/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (6/6 steps found)
• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (4/4 steps found)
• NAD de novo biosynthesis III (5/6 steps found)
• NAD de novo biosynthesis II (from tryptophan) (4/9 steps found)
• nicotine biosynthesis (3/9 steps found)
• superpathway of nicotine biosynthesis (4/12 steps found)
• superpathway of NAD biosynthesis in eukaryotes (4/14 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.19

Sequence Analysis Tools

See E4PIJ4 at UniProt or InterPro

Protein Sequence (279 amino acids)

>HP15_1305 nicotinate-nucleotide pyrophosphorylase (Marinobacter adhaerens HP15)
MIPPELLRQARIENVAQSLREDIGDGDITARLIPADKHATGRVITRETATIAGREWVDEV
FRQVDPAVELNWQVADGETVSPDQVLFTMQGSARSLLSSERAALNWLQSLSGVATACAGY
AARVAHTGVRLLDTRKTLPGLRLAQKYAVTCGGCFNHRIGLWDAFLIKENHIAACGSIAQ
AIEAAHRIAPGKPVEVETENLDELEQALRAGADIIMLDEFSLEDMRTAVATTGGKAKLEA
SGGINADTLVPIAETGVDFISIGALTKDLKAVDLSMRLD