Protein Info for PGA1_c13470 in Phaeobacter inhibens DSM 17395

Annotation: cytochrome C biogenesis protein, transmembrane region

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 transmembrane" amino acids 12 to 40 (29 residues), see Phobius details amino acids 61 to 89 (29 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 136 to 161 (26 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 216 to 240 (25 residues), see Phobius details PF02683: DsbD_TM" amino acids 14 to 229 (216 residues), 67.8 bits, see alignment E=4.3e-23

Best Hits

KEGG orthology group: K06196, cytochrome c-type biogenesis protein (inferred from 87% identity to sit:TM1040_1457)

Predicted SEED Role

"similarity with cytochrome c-type biogenesis protein CcdA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EW98 at UniProt or InterPro

Protein Sequence (250 amino acids)

>PGA1_c13470 cytochrome C biogenesis protein, transmembrane region (Phaeobacter inhibens DSM 17395)
MFGIEIIDAGLIPAMLVALTAGLVSFLSPCVLPIVPPYLAYMSGVSIGEIQGTARARRKA
IVAALFFIMGLSTVFLLLGFTASAFGAFVLQNQELFAQVSGVVVIVFGLHFLSVFRIPLL
DREARMETDQSGGSAVGAYILGLAFAFGWTPCIGPQLGAILSLAATEASVTRGTLLLGIY
ALGLGVPFLLAAIFLTRSMVLMNRIKPYMGVIEKFMGGLLIVVGFMLVTGLFSEFSFWLL
ETFPALATLG