Protein Info for HP15_1301 in Marinobacter adhaerens HP15

Annotation: phosphatidylglycerophosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 34 to 52 (19 residues), see Phobius details amino acids 72 to 110 (39 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 6 to 155 (150 residues), 103.1 bits, see alignment E=9.8e-34

Best Hits

KEGG orthology group: K00995, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [EC: 2.7.8.5] (inferred from 79% identity to maq:Maqu_0948)

Predicted SEED Role

"CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.5

Use Curated BLAST to search for 2.7.8.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PIJ0 at UniProt or InterPro

Protein Sequence (184 amino acids)

>HP15_1301 phosphatidylglycerophosphate synthase (Marinobacter adhaerens HP15)
MHRWRWIPNALTFLRILLIAPFAGALLIGDYRRALLIFFLAAGTDAVDGFLARHFNWRSR
LGAIADPLADKALLITAYLMLTLTAVLPVWLFLLVLGRDLLIVVGALAYHYKVGRYDMEP
SIPGKINTFIQILVALAIIVLLADLPMQPWVVDAGIILVAVSTVFSGGHYLFVWGLRAWR
ATRP