Protein Info for PGA1_c13420 in Phaeobacter inhibens DSM 17395

Annotation: phosphoribosylformylglycinamidine synthase 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01737: phosphoribosylformylglycinamidine synthase I
  • amino acids 1 to 216 (216 residues), 289.5 bits, E=7.4e-91
• PF13507: GATase_5
  • amino acids 2 to 200 (199 residues), 142.8 bits, E=1.1e-45
• PF07685: GATase_3
  • amino acids 23 to 95 (73 residues), 27.2 bits, E=2.8e-10

Best Hits

Swiss-Prot: 88% identical to PURQ_RUEST: Phosphoribosylformylglycinamidine synthase subunit PurQ (purQ) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K01952, phosphoribosylformylglycinamidine synthase [EC: 6.3.5.3] (inferred from 88% identity to sit:TM1040_1463)

MetaCyc: 53% identical to phosphoribosylformylglycinamidine synthetase subunit I (Bacillus subtilis subtilis 168)
Phosphoribosylformylglycinamidine synthase. [EC: 6.3.5.3]

Predicted SEED Role

"Phosphoribosylformylglycinamidine synthase, glutamine amidotransferase subunit (EC 6.3.5.3)" in subsystem De Novo Purine Biosynthesis (EC 6.3.5.3)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (5/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (4/5 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.3

Use Curated BLAST to search for 6.3.5.3

Sequence Analysis Tools

See I7EW92 at UniProt or InterPro

Protein Sequence (222 amino acids)

>PGA1_c13420 phosphoribosylformylglycinamidine synthase 1 (Phaeobacter inhibens DSM 17395)
MKAAVVVFPGSNCDRDLAVAFEQAGCEVSMVWHKDSALPEGIDIVGVPGGFSYGDYLRCG
AIAAQSPICQAVVDHANRGGYAIGVCNGFQILTETGVLPGALLRNAGLKYICRTVDLQVA
TADSVFTEAYTAGDVIGVPIAHHDGNYYADAETVAALQDQDRVAFRYVDNPNGSVADIAG
ILSENRRVLGMMPHPERAADAGHGGTDGAAVFRALAGLVTVA