Protein Info for HP15_1293 in Marinobacter adhaerens HP15

Annotation: iron sulfur binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 PF01883: FeS_assembly_P" amino acids 19 to 91 (73 residues), 43.5 bits, see alignment E=9.1e-15 PF10609: ParA" amino acids 112 to 356 (245 residues), 337.3 bits, see alignment E=1.5e-104 PF13614: AAA_31" amino acids 114 to 152 (39 residues), 36.4 bits, see alignment 1.6e-12 PF09140: MipZ" amino acids 115 to 240 (126 residues), 35.2 bits, see alignment E=2.7e-12 PF01656: CbiA" amino acids 116 to 284 (169 residues), 45.6 bits, see alignment E=2e-15

Best Hits

Swiss-Prot: 57% identical to APBC_SALTY: Iron-sulfur cluster carrier protein (apbC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03593, ATP-binding protein involved in chromosome partitioning (inferred from 90% identity to maq:Maqu_0940)

Predicted SEED Role

"Scaffold protein for [4Fe-4S] cluster assembly ApbC, MRP-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PII2 at UniProt or InterPro

Protein Sequence (379 amino acids)

>HP15_1293 iron sulfur binding protein (Marinobacter adhaerens HP15)
MLKIEHELIPENPMTQISEQALQSAVREFRDPYLNKDLYQLGAVKSLNADERGNVTLMVE
LPYPSKGIAGALKQLVGNALEDVDGVENVDVHVGQKIHSYKVQKDLPSVPGVKNIIAVAS
GKGGVGKSTTAVNLALALQAEGARVGILDADIYGPSIGMMLGVPEGKRPDTRENKYFVPM
DAHGLQANSMAFVVTEKTPMVWRGPMVSGAVMQLLQQTLWNELDYLIVDMPPGTGDIQLT
LAQKVPVTGAVIVTTPQDIALLDGKKGIEMFRKVDIPVLGVVENMSVHICSNCGHEEPLF
GHGGGERIAQEYDTTLLGQLPLHMTIREQTDGGTPSVIAEPDSEVARRYRDIARRVGAEL
STRERNLSGSISSVSVTEH