Protein Info for PGA1_c13380 in Phaeobacter inhibens DSM 17395

Annotation: Predicted integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 713 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 134 to 157 (24 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 199 to 224 (26 residues), see Phobius details amino acids 230 to 253 (24 residues), see Phobius details amino acids 255 to 267 (13 residues), see Phobius details amino acids 269 to 302 (34 residues), see Phobius details PF09924: LPG_synthase_C" amino acids 336 to 592 (257 residues), 138.8 bits, see alignment E=1e-44

Best Hits

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ELD5 at UniProt or InterPro

Protein Sequence (713 amino acids)

>PGA1_c13380 Predicted integral membrane protein (Phaeobacter inhibens DSM 17395)
MPRRPSLAARALTRTATRAARLLLPVAVMLGCLALLQAHVTLPDLAQLRSILSSLAGWQW
AGALVATGVSFWALGRYDSVAHRHLGTGLDGPQARRAGIVAIAISQTLGFGLITGAFARW
RMLKGLRPLRAAQLTGMVAITFLIALAGICGAALLLSPPPVSSPWLGSAILLGTCAMIAV
MVGVPVVRIGRMTLRWPSLTAIAALGFWAMIDVVAAGSALWLLLPASVDLSLAVLLPAYF
LALGVAILSSAPGGAGAFELALCAMLPTHATAEIIAAILAFRLVYYLLPAVLAGLCLCWP
SLTRLALNATNTAPHADDPQALSGSTMRPASHLPHNRPIAEAAVIRQNGGHIHAFGLNQV
ALVDSPQASIALFGAVRGHLAEVLPGLRQHARLRNAVACLYKCTARDAAVCRRARWRVLR
IAQEAVLHPVKFSESGSSRRQLRRKLRQAEKAEICVLPAAPELPIEQMAQIDSAWQAAHG
GAKGTTMGRFQAEYLAQQQVFIAWHRERMVGFVSFHAIAHEWCLDLVRLLPEAPDGTGHA
LIRAAIAEAAALQVPRLSLAAVPDHRFAKRLDLGLRRFKTCFAPMWEDRYVAAPSILHLT
LALGELLRLVHHPAPLPHWSTSAESSLADDNPATEGANSASPGSVTQSGANSVSVTEESL
WRTFERRAAAARKRRRAATDQRQDGSDDDRPLHHGDPPHNEDEENEIALTRRA