Protein Info for PGA1_c13370 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): Methionine synthase component, methyltransferase domain (EC:2.1.1.13)
Rationale: PGA1_c13370 has a methyltransferase domain and its auxotrophic phenotype is rescued by added methionine. Also, S. Thole et al. (ISME J. 2012) proposed that PGA1_c13360, which contains a radical SAM domain (PF04055), might be involved in B12 activation, but it lacks phenotypes in our data. (auxotroph)
Original annotation: putative homocysteine S-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02574: S-methyl_trans
  • amino acids 15 to 293 (279 residues), 201.8 bits, E=1.1e-63

Best Hits

KEGG orthology group: K00548, 5-methyltetrahydrofolate--homocysteine methyltransferase [EC: 2.1.1.13] (inferred from 84% identity to sit:TM1040_1468)

MetaCyc: 100% identical to methionine synthase S-methyltransferase subunit (Phaeobacter inhibens)
Methionine synthase. [EC: 2.1.1.13]

Predicted SEED Role

"Betaine--homocysteine S-methyltransferase (EC 2.1.1.5)" in subsystem Methionine Biosynthesis (EC 2.1.1.5)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• folate transformations III (E. coli) (9/9 steps found)
• folate transformations II (plants) (10/11 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (8/9 steps found)
• glycine betaine degradation I (7/8 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (7/8 steps found)
• L-methionine biosynthesis III (4/4 steps found)
• L-methionine biosynthesis I (4/5 steps found)
• L-methionine salvage from L-homocysteine (2/3 steps found)
• folate transformations I (9/13 steps found)
• glycine betaine degradation II (mammalian) (2/4 steps found)
• superpathway of L-methionine salvage and degradation (9/16 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Methionine metabolism
• One carbon pool by folate

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.13

Use Curated BLAST to search for 2.1.1.13 or 2.1.1.5

Sequence Analysis Tools

See I7EW88 at UniProt or InterPro

Protein Sequence (338 amino acids)

>PGA1_c13370 Methionine synthase component, methyltransferase domain (EC:2.1.1.13) (Phaeobacter inhibens DSM 17395)
MTNTFTTLLETKDALLADGATGTNLFNMGLQSGDAPELWNVDEPKKITALYQGAVDAGSD
LFLTNTFGGTAARLKLHDAHRRVRELNVAGAELGRNVADRSERKIAVAGSVGPTGEIMQP
VGELSHALAVEMFHEQAEALKEGGVDVLWLETISAPEEYRAAAEAFKLADMPWCGTMSFD
TAGRTMMGVTSADMAQLVEEFDPAPLAFGANCGTGASDILRTVLGFAAQGTTRPIISKGN
AGIPKYVDGHIHYDGTPTLMGEYAAMARDCGAKIIGGCCGTMPDHLRAMREALDTRPRGE
QLTLERIVEVLGPFTSDSDGTGEDTAPDRRSRRGRRRG