Protein Info for PGA1_c13370 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): Methionine synthase component, methyltransferase domain (EC:2.1.1.13)
Rationale: PGA1_c13370 has a methyltransferase domain and its auxotrophic phenotype is rescued by added methionine. Also, S. Thole et al. (ISME J. 2012) proposed that PGA1_c13360, which contains a radical SAM domain (PF04055), might be involved in B12 activation, but it lacks phenotypes in our data. (auxotroph)
Original annotation: putative homocysteine S-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF02574: S-methyl_trans" amino acids 15 to 293 (279 residues), 201.8 bits, see alignment E=1.1e-63

Best Hits

KEGG orthology group: K00548, 5-methyltetrahydrofolate--homocysteine methyltransferase [EC: 2.1.1.13] (inferred from 84% identity to sit:TM1040_1468)

MetaCyc: 100% identical to methionine synthase S-methyltransferase subunit (Phaeobacter inhibens)
Methionine synthase. [EC: 2.1.1.13]

Predicted SEED Role

"Betaine--homocysteine S-methyltransferase (EC 2.1.1.5)" in subsystem Methionine Biosynthesis (EC 2.1.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.13

Use Curated BLAST to search for 2.1.1.13 or 2.1.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EW88 at UniProt or InterPro

Protein Sequence (338 amino acids)

>PGA1_c13370 Methionine synthase component, methyltransferase domain (EC:2.1.1.13) (Phaeobacter inhibens DSM 17395)
MTNTFTTLLETKDALLADGATGTNLFNMGLQSGDAPELWNVDEPKKITALYQGAVDAGSD
LFLTNTFGGTAARLKLHDAHRRVRELNVAGAELGRNVADRSERKIAVAGSVGPTGEIMQP
VGELSHALAVEMFHEQAEALKEGGVDVLWLETISAPEEYRAAAEAFKLADMPWCGTMSFD
TAGRTMMGVTSADMAQLVEEFDPAPLAFGANCGTGASDILRTVLGFAAQGTTRPIISKGN
AGIPKYVDGHIHYDGTPTLMGEYAAMARDCGAKIIGGCCGTMPDHLRAMREALDTRPRGE
QLTLERIVEVLGPFTSDSDGTGEDTAPDRRSRRGRRRG