Protein Info for Psest_0131 in Pseudomonas stutzeri RCH2

Annotation: type VI secretion system lysozyme-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 TIGR03357: type VI secretion system lysozyme-like protein" amino acids 5 to 134 (130 residues), 130.4 bits, see alignment E=1.6e-42 PF04965: GPW_gp25" amino acids 29 to 113 (85 residues), 63.6 bits, see alignment E=5.9e-22

Best Hits

KEGG orthology group: K11905, type VI secretion system protein (inferred from 88% identity to pmy:Pmen_0092)

Predicted SEED Role

"Uncharacterized protein similar to VCA0109"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHF0 at UniProt or InterPro

Protein Sequence (135 amino acids)

>Psest_0131 type VI secretion system lysozyme-related protein (Pseudomonas stutzeri RCH2)
MNGYGSLFERLGGDAARRSGWSREVAAMASVAAHLAKMLSTRAGSVQTLPDYGLPDLNDM
RLSLHDSLQQARIAIERFIEAYEPRLTRVRVLSLPRTHDPLSLAFTIEGLLEVDGLKRQV
SFSASLDGSGQVKVQ