Protein Info for PGA1_c13200 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): ABC transporter for D-Sorbitol, permease component 2
Rationale: Specific phenotypes on D-Sorbitol; D-Sorbitol.
Original annotation: ABC transporter permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 70 to 94 (25 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details amino acids 260 to 282 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 84 to 285 (202 residues), 54.8 bits, see alignment E=5.2e-19

Best Hits

KEGG orthology group: K10228, sorbitol/mannitol transport system permease protein (inferred from 92% identity to sit:TM1040_0430)

MetaCyc: 56% identical to polyol ABC-type transporter permease component MtlF (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"Various polyols ABC transporter, permease component 1" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DPP3 at UniProt or InterPro

Protein Sequence (288 amino acids)

>PGA1_c13200 ABC transporter for D-Sorbitol, permease component 2 (Phaeobacter inhibens DSM 17395)
MATQHSRSAARIMMAPAVILLLGWMLVPLTMTLYFSFKKYLPLRGGDLGWVGFDNYARFL
SSSAFWPSVQATLVIVGGVLAITVILGVFLALLLNQPMWGQGIVRILVIAPFFVMPTVSA
LVWKNMFMDPVNGLFAHLWKAFGAEPVSWLSEASLQSIILIVSWQWLPFATLILLTAIQS
LDSEQLEAAEMDGAPPVARFGYITLPHLSRAITVVVLIQTIFLLSIFAEIFVTTQGSFGT
KTLTYLIYQRVLESQNVGLGSAGGVYAIILANIVAIFLMRIVGKNLDA