Protein Info for Psest_1334 in Pseudomonas stutzeri RCH2

Annotation: Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00501: AMP-binding
  • amino acids 30 to 427 (398 residues), 321.2 bits, E=8.4e-100
• PF13193: AMP-binding_C
  • amino acids 478 to 552 (75 residues), 69.4 bits, E=4.2e-23

Best Hits

Swiss-Prot: 53% identical to LCFA_ECOLI: Long-chain-fatty-acid--CoA ligase (fadD) from Escherichia coli (strain K12)

KEGG orthology group: K01897, long-chain acyl-CoA synthetase [EC: 6.2.1.3] (inferred from 93% identity to psa:PST_2961)

MetaCyc: 77% identical to medium-chain-fatty-acid--CoA ligase (Pseudomonas aeruginosa PAO1)
Butyrate--CoA ligase. [EC: 6.2.1.2, 6.2.1.3]

Predicted SEED Role

"Long-chain-fatty-acid--CoA ligase (EC 6.2.1.3)" in subsystem Biotin biosynthesis or n-Phenylalkanoic acid degradation (EC 6.2.1.3)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (51/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• oleate β-oxidation (30/35 steps found)
• fatty acid salvage (6/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• valproate β-oxidation (7/9 steps found)
• long-chain fatty acid activation (1/1 steps found)
• palmitate biosynthesis III (21/29 steps found)
• phytol degradation (3/4 steps found)
• 2-methyl-branched fatty acid β-oxidation (10/14 steps found)
• stearate biosynthesis IV (4/6 steps found)
• γ-linolenate biosynthesis II (animals) (1/2 steps found)
• linoleate biosynthesis II (animals) (1/2 steps found)
• octane oxidation (3/5 steps found)
• alkane biosynthesis II (1/3 steps found)
• oleate biosynthesis I (plants) (1/3 steps found)
• 3-methyl-branched fatty acid α-oxidation (3/6 steps found)
• long chain fatty acid ester synthesis (engineered) (1/4 steps found)
• phosphatidylcholine acyl editing (1/4 steps found)
• wax esters biosynthesis II (1/4 steps found)
• 6-gingerol analog biosynthesis (engineered) (2/6 steps found)
• ceramide degradation by α-oxidation (2/7 steps found)
• sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
• stearate biosynthesis I (animals) (1/6 steps found)
• 2-deoxy-D-ribose degradation II (2/8 steps found)
• arachidonate biosynthesis III (6-desaturase, mammals) (1/7 steps found)
• capsaicin biosynthesis (1/7 steps found)
• icosapentaenoate biosynthesis II (6-desaturase, mammals) (1/7 steps found)
• icosapentaenoate biosynthesis III (8-desaturase, mammals) (1/7 steps found)
• 4-oxopentanoate degradation (1/9 steps found)
• ceramide and sphingolipid recycling and degradation (yeast) (4/16 steps found)
• sporopollenin precursors biosynthesis (4/18 steps found)
• cutin biosynthesis (1/16 steps found)
• suberin monomers biosynthesis (2/20 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Fatty acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.3

Use Curated BLAST to search for 6.2.1.2 or 6.2.1.3

Sequence Analysis Tools

See L0GJB8 at UniProt or InterPro

Protein Sequence (562 amino acids)

>Psest_1334 Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II (Pseudomonas stutzeri RCH2)
MQPEFWNDKRPAGVPNDIDMGVYRSVVEVFERACKTHADRPAFSNMGVTLSYSDLERHSA
AFTAWLQHHTDLQPGDRIAIQMPNLLQYPIAVFGALRAGLIVVNTNPLYTSREMRHQFQD
SGARALVYLNTFGHNVQEVLPDTAIEHLIEVRIGDMLPPLKGVLVNAAVKHLKKMVPDYS
LPQAISFKDVLRDGARHNHKPAPLELDHVAVLQYTGGTTGVAKGAMLTHGNLVANMQQVR
ANMQQLDEHGHPIIREGQEVMIAPLPLYHIYAFTVNCMCMVVTGNHNVLITNPRDINGFV
KELQRWQFSAFLGLNTLFVALMAHPQFKKIDFSRLKGTNSGGTALVSAVAERWKSMTGCT
VVEGYGLTETSPVVCANPHGEHSRLGTVGLPVPGTTVKVIDDEGNALPLGERGELCVKGP
QVMKGYWQRPDATAEVLDEEGWLKTGDIAVIDEDGFVSIVDRKKDLIIVSGFNVYPNEIE
DVVMAHPKVAACAAIGVADEKSGEAVKLFVVPSDPTLDQDELHAYCRENFTGYKMPRHYV
FRDALPMTPVGKILRRELRDIA