Protein Info for HP15_13 in Marinobacter adhaerens HP15

Annotation: short-chain dehydrogenase/reductase SDR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 PF13561: adh_short_C2" amino acids 2 to 220 (219 residues), 170.4 bits, see alignment E=7.5e-54 PF00106: adh_short" amino acids 2 to 166 (165 residues), 129.3 bits, see alignment E=2e-41 PF08659: KR" amino acids 9 to 161 (153 residues), 29 bits, see alignment E=1.5e-10

Best Hits

Swiss-Prot: 35% identical to FABG_STAAM: 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) from Staphylococcus aureus (strain Mu50 / ATCC 700699)

KEGG orthology group: None (inferred from 67% identity to gag:Glaag_0401)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PI72 at UniProt or InterPro

Protein Sequence (242 amino acids)

>HP15_13 short-chain dehydrogenase/reductase SDR (Marinobacter adhaerens HP15)
MVVVDINGNAAKSVVAELESAGHEAIAVQTDVSSETDVKAMIEKTEAHFGRIDILHNNAA
VLSIEQRQRDRDICNLDMDAWDRAIAVNLRGAVLCSKYAIPVMLKHGKGSVIYATSGLGA
QGDLSLTGYACSKAALNMLPKSVAAQYGKSGIRANAVQIGLAPSENAHGSMPSELLDILR
DNHLTPELGTPRQIADVVAFLASDESSFVTGTTIVADGGFGSHTPSLVAMREFFAKSGRE
GM