Protein Info for PGA1_c13130 in Phaeobacter inhibens DSM 17395

Annotation: TRAP transporter, subunit DctM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 transmembrane" amino acids 6 to 33 (28 residues), see Phobius details amino acids 53 to 71 (19 residues), see Phobius details amino acids 98 to 123 (26 residues), see Phobius details amino acids 135 to 162 (28 residues), see Phobius details amino acids 168 to 191 (24 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details amino acids 304 to 323 (20 residues), see Phobius details amino acids 334 to 355 (22 residues), see Phobius details amino acids 376 to 408 (33 residues), see Phobius details amino acids 418 to 447 (30 residues), see Phobius details amino acids 458 to 483 (26 residues), see Phobius details PF06808: DctM" amino acids 8 to 479 (472 residues), 373.8 bits, see alignment E=5.4e-116

Best Hits

KEGG orthology group: None (inferred from 88% identity to sit:TM1040_3358)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DZW1 at UniProt or InterPro

Protein Sequence (491 amino acids)

>PGA1_c13130 TRAP transporter, subunit DctM (Phaeobacter inhibens DSM 17395)
MLIWFLPLFLFLLLIGLPVFFCLLAAPGALLWLNGQERDLTLLYRNLYNGMDSFPLMAIP
FFMLAGELMNRGGITVRLVEFSQALMGHLRGGLAQVNILSSILFAGLSGSAVADTSALGS
MLIPAMEREGYSRKFAAAVTAASSVIGPIIPPSGIMIIYAYVMGESVAALFLAGIVPGVL
VGVGLMIMVRAMADRYELPAARRVVFDSVEIGVMERWFSFGLVRLNLGLLLAQFVPLAEG
AGAQMKWLAFFGAVLFAHGLMLGLRRVVSPAFRTICKRAVVPLQTPVLILGGILAGVFTP
TEAAAVAVAYALLISFLVLGSMRLADLPQVFSRAGITSAVVLLLVGAAMSFKTVVSLSHA
PEQLADFILTLSENPLILLFLINLLLFVVGMFLDAGPAIIILGPILGPVFTDLGVESVHF
AIIMCVNLTVGLATPPMGLVLFVAAAVSQERVTTIAKAILPFLAIEIAVIFLITFVPAIS
LTIPRLTGFLN