Protein Info for Psest_1327 in Pseudomonas stutzeri RCH2

Annotation: Superfamily II DNA/RNA helicases, SNF2 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 949 PF18339: Tudor_1_RapA" amino acids 5 to 55 (51 residues), 82.1 bits, see alignment 7.9e-27 PF18337: Tudor_RapA" amino acids 57 to 118 (62 residues), 76.9 bits, see alignment 4e-25 PF04851: ResIII" amino acids 156 to 315 (160 residues), 46.1 bits, see alignment E=1.8e-15 PF00270: DEAD" amino acids 171 to 315 (145 residues), 25.7 bits, see alignment E=3e-09 PF00176: SNF2-rel_dom" amino acids 172 to 345 (174 residues), 52.1 bits, see alignment E=1.9e-17 PF00271: Helicase_C" amino acids 475 to 585 (111 residues), 54.5 bits, see alignment E=4.6e-18 PF12137: RapA_C" amino acids 589 to 947 (359 residues), 468.4 bits, see alignment E=5.5e-144

Best Hits

Swiss-Prot: 96% identical to RAPA_PSEU5: RNA polymerase-associated protein RapA (rapA) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K03580, ATP-dependent helicase HepA [EC: 3.6.4.-] (inferred from 96% identity to psa:PST_2969)

Predicted SEED Role

"RNA polymerase associated protein RapA (EC 3.6.1.-)" (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.-

Use Curated BLAST to search for 3.6.1.- or 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKF7 at UniProt or InterPro

Protein Sequence (949 amino acids)

>Psest_1327 Superfamily II DNA/RNA helicases, SNF2 family (Pseudomonas stutzeri RCH2)
MAQQYLPGQRWISDSEAELGLGTILTQDGRMLTVLYPATGETRQYATRSAPLTRVRFVPG
DEITHFEGWKMTVREVDDVDGLLVYHGLTAQNEARTLPETQLSNFIQFRLASDRLFAGQI
DPLAWFSLRYHTLQHQSAQLQSSLWGLGGVRAQPIAHQLHIAKEVADRIAPRVLLADEVG
LGKTIEAGLIIHRQLLSGRASRVLILVPENLQHQWLVEMRRRFNLEVALFDAERFIESDA
SNPFEDTQLALVSLEWLKEDERAQDAAFAAGWDVLVVDEAHHLVWHPEGASAEYKLVEQL
AEVIPGVLLLTATPEQLGLDSHFARLRLLDPNRFHDLEAFRAESSSYQPVAEAVQELLDE
GRLSQQAHQTIHDFLGAEGEALLAAATDGDIEASSRLIRELLDRHGTGRLLFRNTRAAVQ
GFPERQLHPYPLPCPAEYLELPLGEHAELYPEVAFQSQQDDGEASNRWWQFDPRVEWLID
TLKMLKKFKVLVICAHAETALDLEDALRVRSGIPATVFHEGMSILERDRAAAYFADEDFG
AQVLICSEIGSEGRNFQFSHHLVLFDLPAHPDLLEQRIGRLDRIGQQHTIQLHVPYLETS
PQERLFTWYHQALNAFLNTCPTGNALQHRFGPQLLAQLEEGDDDAYQLLIDEARAERERL
EAELHSGRDRLLELNSGGGEQGKALVEAIEEQDDQFALPIYMEQLFDAFGIDSEDHSENA
LVLRPSEKMLDASFPLGDDEAVTITYDREQALAREDMQFLTWEHPMVQGGMDLVLSGSMG
NTAVALIKNKALKPGTVLLELLFVSEVVAPRALQLSRFLPPLALRCLLDGNGNDLASKVA
FDTLNDQLESVPRASANKFVQAQRDVLAMQIAAAEAKIAPRHTERVAEAKRKLKAGLDEE
LARLVALQAVNPSVRDSEIEALRQQREEGLAALDKAALRLEAIRVLVAG