Protein Info for HP15_1253 in Marinobacter adhaerens HP15

Annotation: DNA polymerase III, epsilon subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00573: exonuclease, DNA polymerase III, epsilon subunit family
  • amino acids 41 to 211 (171 residues), 81.4 bits, E=3.4e-27
• PF00929: RNase_T
  • amino acids 42 to 200 (159 residues), 84.3 bits, E=1.5e-27

Best Hits

KEGG orthology group: K02342, DNA polymerase III subunit epsilon [EC: 2.7.7.7] (inferred from 79% identity to maq:Maqu_0902)

Predicted SEED Role

"DNA polymerase III epsilon subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

See E4PHQ2 at UniProt or InterPro

Protein Sequence (235 amino acids)

>HP15_1253 DNA polymerase III, epsilon subunit (Marinobacter adhaerens HP15)
MLEQIKQWIEHRRGGKIGSHDPGNLPNPKTPGEQLLTDCRLIVLDLETTGLNPSKDEVIA
IGAVAIRGGIIHLGDQFDLILRRPELDIRETVLIHGIGPEALTQGHEIEDALLYLLEWMN
GDPILAYHSAFDQKFLEKTLKAQLGYTQPHTWMDVADLMPAFFPNTKTGGKGLDNWADYF
GLEVSERHHAASDALATAELTLVALNKARSEGVKTLKGLYDKLHYHRRLQNMHRF