Protein Info for HP15_1252 in Marinobacter adhaerens HP15

Updated annotation (from data): small component of pyruvate transporter (TIGR03647)
Rationale: The data for HP15_1252 is noisy, but it is important for pyruvate utilization, and is 74% identical to Psest_0346, which is also important for pyruvate utilization. HP15_1252 belongs to TIGR03647, which was predicted to be the small subunit of a transporter.
Original annotation: membrane protein containing probable solute: sodium symporter, small subunit domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13937: DUF4212
  • amino acids 10 to 86 (77 residues), 116.4 bits, E=3.1e-38
• TIGR03647: putative solute:sodium symporter small subunit
  • amino acids 11 to 87 (77 residues), 110.3 bits, E=2.1e-36

Best Hits

KEGG orthology group: None (inferred from 94% identity to maq:Maqu_0901)

Predicted SEED Role

"FIG152265: Sodium:solute symporter associated protein"

Sequence Analysis Tools

See E4PHQ1 at UniProt or InterPro

Protein Sequence (88 amino acids)

>HP15_1252 small component of pyruvate transporter (TIGR03647) (Marinobacter adhaerens HP15)
MSAGHSYDAEAYWKANLRLIFGSLIVWALVSYGFAILLRPMLAGIPIGGTDLGFWFAQQG
SILTFIALIFHYAWRMNKIDEKFGVHEE