Protein Info for PGA1_c12940 in Phaeobacter inhibens DSM 17395

Annotation: adenylate kinase Adk

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01351: adenylate kinase
  • amino acids 12 to 221 (210 residues), 247.6 bits, E=5.1e-78
• PF00406: ADK
  • amino acids 14 to 200 (187 residues), 184.5 bits, E=2.7e-58
• PF13207: AAA_17
  • amino acids 15 to 136 (122 residues), 89.2 bits, E=6e-29
• PF05191: ADK_lid
  • amino acids 136 to 172 (37 residues), 44.6 bits, 2.1e-15

Best Hits

Swiss-Prot: 59% identical to KAD_RHOCS: Adenylate kinase (adk) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K00939, adenylate kinase [EC: 2.7.4.3] (inferred from 81% identity to sil:SPO1812)

Predicted SEED Role

"Adenylate kinase (EC 2.7.4.3)" in subsystem Purine conversions (EC 2.7.4.3)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• adenosine ribonucleotides de novo biosynthesis (3/3 steps found)
• purine deoxyribonucleosides salvage (4/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.3

Use Curated BLAST to search for 2.7.4.3

Sequence Analysis Tools

See I7DPM0 at UniProt or InterPro

Protein Sequence (227 amino acids)

>PGA1_c12940 adenylate kinase Adk (Phaeobacter inhibens DSM 17395)
MDTAVLTRPAVLILLGPPGAGKGTQARKLEQGFGLVQLSTGDLLRAAVAAGTPAGLAAKA
VMEAGELVSDEIVINILRDRLAEPDCAKGVILDGFPRTTVQAEALDRLLAESDQQINAAV
SLEVDDAAMVARVAGRYTCGGCGEGYHDQFKQPRVAGTCDACGSTDMTRRADDNAETVTS
RLAAYHAQTAPLISYYDGKGVLNRIDATGEINQIATALSAVVKSATA